Kinesin Heavy Chain 2 (KIF2A) Rabbit Polyclonal Antibody

CAT#: TA334725

Rabbit Polyclonal Anti-KIF2A Antibody

Product Images

WB Suggested Anti-KIF2A Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIF2A antibody: synthetic peptide directed towards the C terminal of human KIF2A. Synthetic peptide located within the following region: ETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVED
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 80 kDa
• Gene Name: kinesin heavy chain member 2A
• Database Link:
  NP_004511
  Entrez Gene 3796 Human
  UniProt ID O00139
• Background: KIF2A belongs to the kinesin-like protein family, MCAK/KIF2 subfamily. It contains 1 kinesin-motor domain. KIF2A plus end-directed microtubule-dependent motor required for normal brain development. It may regulate microtubule dynamics during axonal growth. KIF2A is implicated in formation of bipolar mitotic spindles. It has microtubule depolymerization activity. Hela cells lacking KIF2A show asymmetric or monopolar mitotic spindles. Osteosarcoma cells (U2OS) lacking KIF2A or KIF2B show disorganised or monopolar mitotic spindles.Kinesins, such as KIF2, are microtubule-associated motor proteins. For background information on kinesins, see MIM 148760. [supplied by OMIM]
• Synonyms: CDCBM3; HK2; KIF2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome