Primary Antibodies

View as table Download

Rabbit polyclonal antibody to protein S (alpha) (protein S (alpha))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 209 and 477 of Protein S (Uniprot ID#P07225)

Protein S (PROS1) goat polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen Freund’s complete adjuvant is used in the first step of the immunization procedure.

Protein S (PROS1) sheep polyclonal antibody, Ig Fraction

Applications ELISA, WB
Immunogen Highly pure Protein S, prepared from Human plasma by chromatographic methods

Rabbit polyclonal Anti-PROS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PROS1 antibody: synthetic peptide directed towards the middle region of human PROS1. Synthetic peptide located within the following region: MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL

Rabbit polyclonal Anti-Pros1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Pros1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS

Anti-PROS1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 484-666 amino acids of human protein S (alpha)

Anti-PROS1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 484-666 amino acids of human protein S (alpha)