Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to TBCK (TBC1 domain containing kinase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 457 and 694 of TBCK (Uniprot ID#Q8TEA7)

Rabbit Polyclonal Anti-TBCK

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MGC16169 antibody: synthetic peptide directed towards the middle region of human MGC16169. Synthetic peptide located within the following region: PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA