HSPC302 (TBCK) Rabbit Polyclonal Antibody

CAT#: TA339174

Rabbit Polyclonal Anti-TBCK

Product Images

WB Suggested Anti-TBCK Antibody Titration: 0.2-1 ug/ml; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MGC16169 antibody: synthetic peptide directed towards the middle region of human MGC16169. Synthetic peptide located within the following region: PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 94 kDa
• Gene Name: TBC1 domain containing kinase
• Database Link:
  NP_149106
  Entrez Gene 93627 Human
  UniProt ID Q8TEA7
• Background: The function of this protein remains unknown.
• Synonyms: HSPC302; IHPRF3; TBCKL
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase