Antibodies

Jump to Filters
View as table Download
HSPC302 (TBCK) Rabbit Polyclonal Antibody
TA372757

USD 380.00

4 Weeks

TBCK rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TBCK
HSPC302 (TBCK) Rabbit Polyclonal Antibody
TA308157

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to TBCK (TBC1 domain containing kinase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 457 and 694 of TBCK (Uniprot ID#Q8TEA7)
HSPC302 (TBCK) Rabbit Polyclonal Antibody
TA339174

USD 375.00

5 Days

Rabbit Polyclonal Anti-TBCK

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MGC16169 antibody: synthetic peptide directed towards the middle region of human MGC16169. Synthetic peptide located within the following region: PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA
TBCK Rabbit Polyclonal Antibody
TA368525

USD 380.00

4 Weeks

TBCK rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TBCK