Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GNL3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNL3 antibody: synthetic peptide directed towards the middle region of human GNL3. Synthetic peptide located within the following region: RKQEEREDDKDSDQETVDEEVDENSSGMFAAEETGEALSEETTAGEQSTR

Rabbit Polyclonal Anti-GNL3 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNL3 antibody: synthetic peptide directed towards the N terminal of human GNL3. Synthetic peptide located within the following region: MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR

Goat Anti-GNL3 (aa115-126) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TENKAKSGKQNS, from the internal region of the protein sequence according to NP_055181.3; NP_996561.1.

Rabbit Polyclonal Anti-GNL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GNL3