Nucleostemin (GNL3) Rabbit Polyclonal Antibody

CAT#: TA344186

Rabbit Polyclonal Anti-GNL3 Antibody - N-terminal region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "GNL3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GNL3 antibody: synthetic peptide directed towards the N terminal of human GNL3. Synthetic peptide located within the following region: MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 60 kDa
Gene Name G protein nucleolar 3
Background GNL3 may be required to maintain the proliferative capacity of stem cells and may play an important role in tumorigenesis.
Synonyms C77032; E2IG3; NNP47; NS
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Bovine: 93%; Dog: 86%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families ES Cell Differentiation/IPS, Stem cell - Pluripotency

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.