Nucleostemin (GNL3) Rabbit Polyclonal Antibody

CAT#: TA344186

Rabbit Polyclonal Anti-GNL3 Antibody - N-terminal region

Product Images

WB Suggested Anti-GNL3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GNL3 antibody: synthetic peptide directed towards the N terminal of human GNL3. Synthetic peptide located within the following region: MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: G protein nucleolar 3
• Database Link:
  NP_996561
  Entrez Gene 30877 MouseEntrez Gene 26354 Human
  UniProt ID Q9BVP2
• Background: GNL3 may be required to maintain the proliferative capacity of stem cells and may play an important role in tumorigenesis.
• Synonyms: C77032; E2IG3; NNP47; NS
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Bovine: 93%; Dog: 86%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Stem cell - Pluripotency