Rabbit Polyclonal Anti-GNL3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNL3 antibody: synthetic peptide directed towards the middle region of human GNL3. Synthetic peptide located within the following region: RKQEEREDDKDSDQETVDEEVDENSSGMFAAEETGEALSEETTAGEQSTR |
Rabbit Polyclonal Anti-GNL3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNL3 antibody: synthetic peptide directed towards the N terminal of human GNL3. Synthetic peptide located within the following region: MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR |
Goat Anti-GNL3 (aa115-126) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TENKAKSGKQNS, from the internal region of the protein sequence according to NP_055181.3; NP_996561.1. |
Carrier-free (BSA/glycerol-free) GNL3 mouse monoclonal antibody,clone OTI5B1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GNL3 mouse monoclonal antibody,clone OTI6F1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GNL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GNL3 |
GNL3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GNL3 |
GNL3 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human GNL3 (NP_996562.1). |
| Modifications | Unmodified |
GNL3 mouse monoclonal antibody,clone OTI5B1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GNL3 mouse monoclonal antibody,clone OTI5B1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
GNL3 mouse monoclonal antibody,clone OTI5B1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GNL3 mouse monoclonal antibody,clone OTI5B1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GNL3 mouse monoclonal antibody,clone OTI6F1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GNL3 mouse monoclonal antibody,clone OTI6F1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
GNL3 mouse monoclonal antibody,clone OTI6F1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GNL3 mouse monoclonal antibody,clone OTI6F1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
