Primary Antibodies

View as table Download

Goat Polyclonal Antibody against Tafazzin

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HLKTQAEQLHNH, from the C Terminus of the protein sequence according to NP_000107.1; NP_851828.1; NP_851829.1; NP_851830.1.

Rabbit polyclonal anti-TAZ (tafazzin) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TAZ.

Rabbit Polyclonal Anti-TAZ Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAZ antibody is: synthetic peptide directed towards the C-terminal region of TAZ. Synthetic peptide located within the following region: PNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQ