Primary Antibodies

View as table Download

Rabbit polyclonal Smad2 (Ab-465) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Smad2.

Rabbit polyclonal Smad2 (Ser465) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Smad2 around the phosphorylation site of serine 465.
Modifications Phospho-specific

Anti-NODAL Goat Polyclonal Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Monkey, Pig
Immunogen NODAL antibody was raised against synthetic peptide (DRSQLCRKVKFQ) from internal region of human NODAL. Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Panda, Bovine, Dog, Bat, Horse, Pig (100%); Mouse, Rat, Hamster (92%); Elephant (83%).

Rabbit polyclonal anti-BMP-6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human BMP-6

Rabbit polyclonal anti-SMAD3 antibody

Applications IHC, WB
Reactivities Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein.

Anti-SMAD2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.218~222 (P-E-T-P-P) derived from Human Smad2.

Anti-SMAD3 Rabbit Polyclonal Antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.423~427 (C-S-S-V-S) derived from Human Smad3.

Rabbit polyclonal SMAD9 Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SMAD9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the Central region of human SMAD9.

Rabbit polyclonal SMAD6 Antibody (Center)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SMAD6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-386 amino acids from the Central region of human SMAD6.

Rabbit polyclonal SMAD2 Antibody (T220)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 201-230 amino acids from human SMAD2.

Rabbit Polyclonal Smad1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Smad1

Rabbit Polyclonal Smad1 (Ser187) Antibody (Phospho-specific)

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Smad1 around the phosphorylation site of Serine 187
Modifications Phospho-specific

Rabbit Polyclonal Smad2 (Ser250) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Smad2 around the phosphorylation site of Serine 250
Modifications Phospho-specific

Rabbit Polyclonal Smad2 (Ser467) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Smad2 around the phosphorylation site of Serine 467
Modifications Phospho-specific

Rabbit Polyclonal Smad3 (Ser425) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Smad3 around the phosphorylation site of Serine 425
Modifications Phospho-specific

Rabbit Polyclonal SP1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SP1

Rabbit Polyclonal SP1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SP1

Rabbit Polyclonal Anti-SMAD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMAD6 antibody: synthetic peptide directed towards the N terminal of human SMAD6. Synthetic peptide located within the following region: GAPRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKRLKE

Rabbit Polyclonal Anti-BMP7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ

Rabbit Polyclonal SMAD6 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Primate, Sheep
Conjugation Unconjugated
Immunogen This antibody was developed against 2 synthetic peptides found between amino acids 30-150 and 300-400 of human SMAD6 (GenBank Accession No. AAH12986.1). These peptide sequences are specific to SMAD6, and have high homology to SMAD6 in multiple species.

Rabbit Polyclonal Smad2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Primate
Conjugation Unconjugated
Immunogen Amino acids 234-249 (DQQLNQSMDTGSPAEL) of human SMAD2 protein was used as the immunogen.

Rabbit Polyclonal Anti-Tgfb1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Tgfb1 antibody: synthetic peptide directed towards the middle region of mouse Tgfb1. Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV

Rabbit Polyclonal Anti-BMP5 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Bmp5 antibody is: synthetic peptide directed towards the C-terminal region of Rat Bmp5. Synthetic peptide located within the following region: NKSSSHQDPSRIPSAGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEG

Mouse Monoclonal Smad2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

ID3 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI15E3

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700104

ID3 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI15F4

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700103

SMAD6 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

ERK1 (MAPK3) (+ERK2) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

BMP8B rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human

SP1 pThr739 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

SMAD2 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

SMAD2 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

ID3 (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human
Immunogen ID3 antibody was raised against synthetic peptide corresponding to C-terminal of human Id3

SMAD1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Rat
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human Smad 1,2,3,5 (442-456aa), identical to the related rat sequence

BMP7 rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen Highly pure (>95%) recombinant Human BMP-7 (Ala316-His431) derived from E. coli.

BMP7 rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen Highly pure (>95%) recombinant Human BMP-7 (Ala316-His431) derived from E. coli.

Goat Polyclonal Antibody against ERK1 / MAPK3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence GGEPRRTEGVGP-C, from the N Terminus of the protein sequence according to NP_002737.1.

Goat Polyclonal Antibody against SMAD2 / MADH2

Applications WB
Reactivities Human
Immunogen Peptide with sequence SEIWGLSTPNTIDC, from the internal region of the protein sequence according to NP_005892.

Goat Polyclonal Antibody against SP1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence CSRIESPNENSNNSQ, from the internal region of the protein sequence according to NP_612482.2.

Goat Polyclonal Antibody against ACVR1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RKFKRRNQERLNPRD, from the internal region of the protein sequence according to NP_001096.1.

Rabbit Polyclonal ACVR1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ACVR1 antibody was raised against a 14 amino acid synthetic peptide near the amino terminus of the human ACVR1. The immunogen is located within the first 50 amino acids of ACVR1.

Rabbit Polyclonal ACVR1C Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ACVR1C antibody was raised against a 15 amino acid peptide near the amino terminus of the human ACVR1C.

Rabbit anti-SMAD1 (Phospho-Ser465) polyclonal antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized phosphopeptide derived from human Smad1 around the phosphorylation site of serine 465 (I-S-S-V-SP).
Modifications Phospho-specific

Rabbit anti-SMAD2 (Phospho-Ser467) polyclonal antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized phosphopeptide derived from human Smad2 around the phosphorylation site of serine 467 (C-S-S-M-SP).
Modifications Phospho-specific

Goat Anti-NODAL Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence ECPNPVGEEFH, from the internal region of the protein sequence according to NP_060525.2.

BMP5 Rabbit Polyclonal (aa31-46) Antibody

Applications IHC
Reactivities Human
Immunogen BMP5 antibody was raised against synthetic peptide from human BMP5.

Rabbit polyclonal anti-BMP-5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant human BMP-5

Rabbit polyclonal anti-BMP-5 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 29 of human BMP-5

Rabbit polyclonal anti-SMAD2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Smad23 protein.