Rabbit Polyclonal TAT Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal TAT Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO28
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO34
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against thyroid peroxidase
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TRHVIQVSNEVVTDD, from the internal region of the protein sequence according to NP_000538.3; NP_783650.1; NP_783652.1; NP_783653.1. |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO35
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TPO Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPO antibody is: synthetic peptide directed towards the N-terminal region of Human TPO. Synthetic peptide located within the following region: GASNTALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVS |
Carrier-free (BSA/glycerol-free) TAT mouse monoclonal antibody,clone OTI3G6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-TPO Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-TAT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tyrosine aminotransferase |
TAT mouse monoclonal antibody,clone OTI3G6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TAT mouse monoclonal antibody,clone OTI3G6, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TAT mouse monoclonal antibody,clone OTI3G6, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TAT mouse monoclonal antibody,clone OTI3G6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |