Primary Antibodies

Jump to Filters
View as table Download
SCN3B Rabbit Polyclonal Antibody
TA331466

USD 375.00

5 Days

Rabbit polyclonal Anti-SCN3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN3B antibody: synthetic peptide directed towards the N terminal of human SCN3B. Synthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND
SCN3B Rabbit Polyclonal Antibody
TA590260

USD 409.00

In Stock

Rabbit Polyclonal SCN3B Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.