SCN3B Rabbit Polyclonal Antibody

CAT#: TA331466

Rabbit polyclonal Anti-SCN3B Antibody

Product Images

WB Suggested Anti-SCN3B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SCN3B antibody: synthetic peptide directed towards the N terminal of human SCN3B. Synthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: sodium voltage-gated channel beta subunit 3
• Database Link:
  NP_060870
  Entrez Gene 55800 Human
  UniProt ID Q9NY72
• Background: SCN3B is one member of the sodium channel beta subunits of voltage-gated sodium channels, which are responsible for the generation and propagation of action potentials in neurons and muscle. SCN3B influences the inactivation kinetics of the sodium channel.
• Synonyms: ATFB16; BRGDA7; HSA243396; SCNB3
• Note: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Sodium, Transmembrane