Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CYP26B1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP26B1 antibody: synthetic peptide directed towards the N terminal of human CYP26B1. Synthetic peptide located within the following region: LRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGSGFQSSRREKYGNVF

Rabbit Polyclonal Anti-CYP26B1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP26B1 antibody: synthetic peptide directed towards the middle region of human CYP26B1. Synthetic peptide located within the following region: SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT

Goat Anti-CYP26B1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-SQARSEDKDGRFH, from the internal region of the protein sequence according to NP_063938.1.

Carrier-free (BSA/glycerol-free) CYP26B1 mouse monoclonal antibody,clone OTI4A8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated