Primary Antibodies

Jump to Filters
View as table Download
PTPN13 Rabbit Polyclonal Antibody
TA343796

USD 475.00

5 Days

Rabbit Polyclonal Anti-EWSR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the N terminal of human EWSR1. Synthetic peptide located within the following region: PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ
PTPN13 Rabbit Polyclonal Antibody
TA336328

USD 424.00

5 Days

Rabbit Polyclonal PTPN13/PTPL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A recombinant protein corresponding to amino acids 1279 to 1883 of human FAP-1 protein was used as immunogen; GenBank no. NP_542414.1.
PTPN13 Rabbit Polyclonal Antibody
TA351181

USD 345.00

In Stock

Rabbit Polyclonal Anti-PTPN13 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PTPN13