PTPN13 Rabbit Polyclonal Antibody

CAT#: TA343796

Rabbit Polyclonal Anti-EWSR1 Antibody

Product Images

WB Suggested Anti-EWSR1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateEWSR1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the N terminal of human EWSR1. Synthetic peptide located within the following region: PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: protein tyrosine phosphatase, non-receptor type 13
• Database Link:
  NP_006255
  Entrez Gene 5783 Human
  UniProt ID Q12923
• Background: EWSR1 is a putative RNA binding protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors.
• Synonyms: FAP-1; hPTP1E; PNP1; PTP-BAS; PTP-BL; PTP1E; PTPL1; PTPLE
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Phosphatase