Primary Antibodies

Jump to Filters
View as table Download
PPM1A Rabbit Polyclonal Antibody
TA344616

USD 475.00

5 Days

Rabbit Polyclonal Anti-PPM1A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPM1A antibody: synthetic peptide directed towards the middle region of human PPM1A. Synthetic peptide located within the following region: EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK
PPM1A Mouse Monoclonal Antibody [Clone ID: 4E11]
AM31765PU-N

USD 480.00

2 Weeks

PPM1A mouse monoclonal antibody, clone 4E11, Purified

Applications ELISA, IHC, WB
Reactivities Human