Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-STK33 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human STK33. |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-STK33 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-STK33 antibody is: synthetic peptide directed towards the C-terminal region of Human STK33. Synthetic peptide located within the following region: NVLEMMKEWKNNPESVEENTTEEKNKPSTEEKLKSYQPWGNVPDANYTSD |
Rabbit Polyclonal Anti-STK33 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-STK33 antibody is: synthetic peptide directed towards the N-terminal region of Human STK33. Synthetic peptide located within the following region: VPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDITSRKDLPSRTSNVE |
Rabbit Polyclonal Anti-STK33 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human STK33 |
Active filters
Target Symbol
- STK33
Reactivities
- Human
Families
- Protein Kinase