STK33 Rabbit Polyclonal Antibody

CAT#: TA331233

Rabbit Polyclonal Anti-STK33 Antibody

Product Images

WB Suggested Anti-STK33 Antibody; Titration: 1.0 ug/ml; Positive Control: MCF7 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-STK33 antibody is: synthetic peptide directed towards the N-terminal region of Human STK33. Synthetic peptide located within the following region: VPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDITSRKDLPSRTSNVE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: serine/threonine kinase 33
• Database Link:
  NP_112168
  Entrez Gene 65975 Human
  UniProt ID Q9BYT3
• Background: STK33 is a serine/threonine protein kinase which phosphorylates VIME. STK33 may play a specific role in the dynamic behavior of the intermediate filament cytoskeleton by phosphorylation of VIME By similarity. STK33 is not essential for the survival of KRAS-dependent AML cell lines.
• Synonyms: OTTHUMP00000178934; OTTHUMP00000178935; serine; threonine kinase 33
• Note: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase