SIL1 (448-461) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from C-term of human SIL1 |
SIL1 (448-461) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from C-term of human SIL1 |
Rabbit Polyclonal Anti-SIL1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SIL1 Antibody: synthetic peptide directed towards the N terminal of human SIL1. Synthetic peptide located within the following region: KETKAEEELDAEVLEVFHPTHEWQALQPGQAVPAGSHVRLNLQTGEREAK |
SIL1 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human SIL1 |
Goat Polyclonal Antibody against BAP / SIL1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ELLGSVNSLLKELR, from the C Terminus of the protein sequence according to NP_071909.1. |
Rabbit Polyclonal Anti-SIL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SIL1 Antibody: synthetic peptide directed towards the C terminal of human SIL1. Synthetic peptide located within the following region: KLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCR |
Carrier-free (BSA/glycerol-free) SIL1 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SIL1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SIL1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SIL1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SIL1 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SIL1 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SIL1 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-SIL1 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-SIL1 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SIL1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SIL1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-SIL1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-SIL1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SIL1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-SIL1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-SIL1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-SIL1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SIL1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SIL1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-SIL1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-SIL1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SIL1 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SIL1 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-SIL1 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-SIL1 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |