Germany
Japan
United Kingdom
China
USD 484.00
In Stock
Primary Antibodies
View as table Download
APOH / Apolipoprotein H Goat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | APOH / Apolipoprotein H antibody was raised against human beta2-Glycoprotein-I (beta2GP-I) purified from plasma. |
APOH Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human APOH |
Apolipoprotein H (APOH) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IHC |
| Reactivities | Canine, Human, Porcine, Rat |
| Immunogen | Purified beta2-Glycoprotein-I (beta2GP-I) from human plasma. This protein is also known as apolipoprotein-H. |
Rabbit Polyclonal Anti-APOH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APOH antibody: synthetic peptide directed towards the middle region of human APOH. Synthetic peptide located within the following region: PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHG |
Goat Polyclonal Antibody against APOH (aa145-157)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PSIPTFATLRVYK, from the internal region of the protein sequence according to NP_000033.2. |
Goat Anti-Apolipoprotein H Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QGERVKIQEKFKN, from the internal region of the protein sequence according to NP_000033.2 |
Rabbit Polyclonal Anti-APOH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APOH antibody: synthetic peptide directed towards the N terminal of human APOH. Synthetic peptide located within the following region: LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD |
Carrier-free (BSA/glycerol-free) APOH mouse monoclonal antibody, clone OTI10A6 (formerly 10A6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
APOH mouse monoclonal antibody, clone OTI10A6 (formerly 10A6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
APOH mouse monoclonal antibody, clone OTI10A6 (formerly 10A6), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
APOH mouse monoclonal antibody, clone OTI10A6 (formerly 10A6), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
APOH mouse monoclonal antibody, clone OTI10A6 (formerly 10A6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- APOH
Families
- Secreted Protein