Apolipoprotein H (APOH) Rabbit Polyclonal Antibody

CAT#: TA339868

Rabbit Polyclonal Anti-APOH Antibody

Product Images

WB Suggested Anti-APOH Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-APOH antibody: synthetic peptide directed towards the middle region of human APOH. Synthetic peptide located within the following region: PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: apolipoprotein H
• Database Link:
  NP_000033
  Entrez Gene 350 Human
  UniProt ID P02749
• Background: Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antipho
• Synonyms: B2G1; B2GP1; BG
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 92%; Pig: 91%; Mouse: 86%; Guinea pig: 86%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein