Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-FOLR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOLR2 antibody is: synthetic peptide directed towards the C-terminal region of Human FOLR2. Synthetic peptide located within the following region: LCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNA

Carrier-free (BSA/glycerol-free) FOLR2 mouse monoclonal antibody, clone OTI8G1 (formerly 8G1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FOLR2 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FOLR2 mouse monoclonal antibody, clone OTI4G6 (formerly 4G6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

FOLR2 mouse monoclonal antibody, clone OTI8G1 (formerly 8G1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

FOLR2 mouse monoclonal antibody, clone OTI8G1 (formerly 8G1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

FOLR2 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

FOLR2 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

FOLR2 mouse monoclonal antibody, clone OTI4G6 (formerly 4G6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

FOLR2 mouse monoclonal antibody, clone OTI4G6 (formerly 4G6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated