Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-SERPINB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPINB2 antibody: synthetic peptide directed towards the middle region of human SERPINB2. Synthetic peptide located within the following region: GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ |
SERPINB2 (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human PAI2 |
Rabbit polyclonal Plasminogen Activator Inhibitor 2 antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal area of human PAI-2 protein. |
Rabbit Polyclonal Anti-SERPINB2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SERPINB2 |
USD 420.00
5 Days
SERPINB2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
SERPINB2 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
SERPINB2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
SERPINB2 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
SERPINB2 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
SERPINB2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- SERPINB2
Families
- Secreted Protein