SERPINB2 Rabbit Polyclonal Antibody

CAT#: TA337675

Rabbit Polyclonal Anti-SERPINB2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SERPINB2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SERPINB2 antibody: synthetic peptide directed towards the middle region of human SERPINB2. Synthetic peptide located within the following region: GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 44 kDa
Gene Name serpin family B member 2
Background SERPINB2 inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.
Synonyms HsT1201; PAI; PAI-2; PAI2; PLANH2
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Sheep: 86%; Bovine: 86%; Rat: 85%
Reference Data
Protein Families Druggable Genome, Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.