SERPINB2 Rabbit Polyclonal Antibody

CAT#: TA337675

Rabbit Polyclonal Anti-SERPINB2 Antibody

Product Images

WB Suggested Anti-SERPINB2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Liver

• 

  2Hum. Adult Placenta; Host: Rabbit; Target Name: CHAD; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

• 

  3Hum. Fetal Lung; Host: Rabbit; Target Name: NSUN6; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SERPINB2 antibody: synthetic peptide directed towards the middle region of human SERPINB2. Synthetic peptide located within the following region: GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: serpin family B member 2
• Database Link:
  NP_002566
  Entrez Gene 5055 Human
  UniProt ID P05120
• Background: SERPINB2 inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.
• Synonyms: HsT1201; PAI; PAI-2; PAI2; PLANH2
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Sheep: 86%; Bovine: 86%; Rat: 85%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein