Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-UVRAG Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen UVRAG antibody was raised against an 18 amino acid peptide near the carboxy terminus of human UVRAG.

Rabbit anti-CDK1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Center-peptide of human CDK1

Phospho-CDK1-T161 Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T161 of human CDK1
Modifications Phospho-specific

Rabbit polyclonal CDC2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CDC2.

Rabbit Polyclonal Anti-CDC2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF

Rabbit Polyclonal Anti-CDC2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP

Rabbit Polyclonal Anti-CDC2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 Antibody: A synthesized peptide derived from human CDC2

Rabbit Polyclonal CDC2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC2

Rabbit Polyclonal CDC2 (Tyr15) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC2 around the phosphorylation site of Tyrosine 15
Modifications Phospho-specific

Rabbit polyclonal CDC2 (Ab-161) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CDC2 around the phosphorylation site of Threonine161.

Rabbit Polyclonal Anti-CDK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM

Rabbit Polyclonal Anti-CDK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the N terminal of human CDC2. Synthetic peptide located within the following region: EDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIRE

Rabbit Polyclonal Anti-TUBA3C Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL

Rabbit anti CDC2 (pY15) (CDK1) Polyclonal Antibody

Applications Dot, WB
Reactivities Bovine, Chicken, Human
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -GTYGV- with a phosphorylation site at Tyr15 of human CDC2 protein. This sequence is identical among human, mouse, rat, bovine and chicken species.

Rabbit anti CDC2 (Paired Y15) (CDK1) Polyclonal Antibody

Applications Dot, WB
Reactivities Bovine, Chicken, Human
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -GTYGV- without a phosphorylation site at Tyr15 of human CDC2 protein. This sequence is identical among human, mouse, rat, bovine and chicken species.

Rabbit anti CDC2 Polyclonal Antibody

Applications IHC, WB
Reactivities Bovine, Chicken, Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of CDC2 protein from human, rat and mouse origins

Rabbit Polyclonal Alpha-tubulin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Rabbit polyclonal Tubulin antibody was raised against a 16 amino acid peptide near the amino terminus of human Tubulin.

Rabbit Polyclonal Anti-CDK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: KLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGT

Phospho-CDK1-Y15 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y15 of human CDK1
Modifications Phospho-specific

Rabbit Polyclonal Anti-TUBA3C Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR

Mouse monoclonal Anti-pTpY cdk1 Clone CP3.2

Reactivities Frog, Mammalian
Conjugation Unconjugated

Anti-CDK1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human Cyclin-dependent kinase 1