Primary Antibodies

View as table Download

GDF 5 (GDF5) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen conjugated synthetic peptide between 350-379 amino acids from the C-terminal region of human BMP14 / GDF5

Rabbit Polyclonal Anti-GDF5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GDF5 antibody is: synthetic peptide directed towards the C-terminal region of GDF5. Synthetic peptide located within the following region: YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP