GDF 5 (GDF5) Rabbit Polyclonal Antibody

CAT#: TA343293

Rabbit Polyclonal Anti-GDF5 Antibody

Product Images

WB Suggested Anti-GDF5 Antibody; Titration: 1.0 ug/ml; Positive Control: Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GDF5 antibody is: synthetic peptide directed towards the C-terminal region of GDF5. Synthetic peptide located within the following region: YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: growth differentiation factor 5
• Database Link:
  NP_000548
  Entrez Gene 14563 MouseEntrez Gene 8200 Human
  UniProt ID P43026
• Background: The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Mutations in this gene are associated with acromesomelic dysplasia, Hunter-Thompson type; brachydactyly, type C; and chondrodysplasia, Grebe type. These associations confirm that the gene product plays a role in skeletal development.
• Synonyms: BDA1C; BMP-14; BMP14; CDMP1; LAP-4; LAP4; OS5; SYM1B; SYNS2
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - TGFb/BMP signaling pathway
• Protein Pathways: Cytokine-cytokine receptor interaction, TGF-beta signaling pathway