Rabbit Polyclonal Anti-WNT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT1 antibody: synthetic peptide directed towards the middle region of human WNT1. Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV |
Rabbit Polyclonal Anti-Wnt8b Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Wnt8b Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Wnt8b. Synthetic peptide located within the following region: IADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWE |
Rabbit Polyclonal Anti-DKK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DKK1 antibody is: synthetic peptide directed towards the C-terminal region of Human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD |
Rabbit Polyclonal Anti-WNT2 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | WNT2 / IRP antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset (100%); Galago, Mouse, Rat, Ferret, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Cat, Bat, Rabbit, Pig, Opossum, Guinea pig, Turkey, Chicken, Armadillo, Platypus (93%); Horse (87%). |
Rabbit anti Cyclin D1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human cyclin D1 protein. This sequence is identical to human, mouse, rat. |
Rabbit anti FGF 4 (NT) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of Fibroblast Growth Factor 4 protein. This sequence is identical to human, mouse, rat and bovine. |
Rabbit anti FGF4 (IN) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal sequence of Fibroblast Growth Factor 4 protein. This sequence is identical to human, mouse, rat and bovine. |
Rabbit anti FGF4 (NT1) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of Fibroblast Growth Factor 4 protein. This sequence is identical to human, mouse, rat and bovine. |
Rabbit anti FGF4 (NT2) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of Fibroblast Growth Factor 4 protein. This sequence is identical to human, mouse, rat and bovine. |
Rabbit anti Myc(pT358) Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit anti Myc(pT58) Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CCND1 mouse monoclonal antibody,clone OTI8B2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) CCND1 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) CCND1 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTBP2 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-CCND1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1 |
Anti-SFRP1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 42-58 amino acids of Human secreted frizzled-related protein 1 |
Anti-FGF4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 192-206 amino acids of Human fibroblast growth factor 4 |
Anti-CTBP2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human C-terminal binding protein 2 |
Rabbit Polyclonal Anti-DKK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DKK1 |
Rabbit Polyclonal Anti-WNT3A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human WNT3A |
Rabbit Polyclonal Anti-WNT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human WNT2 |
Rabbit Polyclonal Anti-AXIN1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human AXIN1 |
c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
WNT3A Rabbit monoclonal antibody,clone OTIR4G6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
WNT3A Rabbit monoclonal antibody,clone OTIR4G6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
