WNT1 Rabbit Polyclonal Antibody

CAT#: TA329904

Rabbit Polyclonal Anti-WNT1 Antibody

Product Images

WB Suggested Anti-WNT1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Muscle

• 

  Sample Type: 1. Molecular Weight; 2. Control (20 ug); 3. shRNA1-WNT1 H9 hES cells (20 ug); 4.shRNA2-WNT1 H9 hES cells (20ug); Primary Dilution: 1:1000; Secondary Antibody: anti-Rabbit HRP; Secondary Dilution: 1:5000; Image Submitted By: Jingli Cai; Thomas

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WNT1 antibody: synthetic peptide directed towards the middle region of human WNT1. Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: Wnt family member 1
• Database Link:
  NP_005421
  Entrez Gene 22408 MouseEntrez Gene 7471 Human
  UniProt ID P04628
• Background: WNT1 is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT1 is very conserved in evolution, and it is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. WNT1 was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. WNT1 is clustered with another family member, WNT10B, in the chromosome 12q13 region.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is very conserved in evolution, and the protein encoded by this gene is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. This gene was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. This gene is clustered with another family member, WNT10B, in the chromosome 12q13 region. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: BMND16; INT1; OI15
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway, Transmembrane
• Protein Pathways: Basal cell carcinoma, Hedgehog signaling pathway, Melanogenesis, Pathways in cancer, Wnt signaling pathway