Rabbit Polyclonal Anti-CRABP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRABP2 antibody: synthetic peptide directed towards the middle region of human CRABP2. Synthetic peptide located within the following region: AAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKS |
Anti-CRABP2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.87~91(K-W-E-S-E) derived from Human CRABP2 |
Rabbit Polyclonal Anti-CRABP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRABP2 antibody: synthetic peptide directed towards the middle region of human CRABP2. Synthetic peptide located within the following region: FEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELI |
Rabbit polyclonal anti-CRABP2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CRABP2. |
Rabbit Polyclonal Anti-CRABP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRABP2 antibody is: synthetic peptide directed towards the middle region of Human CRABP2. Synthetic peptide located within the following region: PCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVV |
Rabbit Polyclonal Anti-CRABP2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CRABP2 |
Germany
Japan
United Kingdom
China