Primary Antibodies

Jump to Filters
View as table Download
MAFK Mouse Monoclonal Antibody [Clone ID: AT2F7]
AM50032PU-N

USD 340.00

2 Weeks

MAFK mouse monoclonal antibody, clone AT2F7, Purified

Applications ELISA, WB
Reactivities Human
MAFK Mouse Monoclonal Antibody [Clone ID: AT2F7]
AM50032PU-S

USD 230.00

2 Weeks

MAFK mouse monoclonal antibody, clone AT2F7, Purified

Applications ELISA, WB
Reactivities Human
MAFK Rabbit Polyclonal Antibody
TA342419

USD 310.00

5 Days

Rabbit Polyclonal Anti-MAFK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAFK antibody: synthetic peptide directed towards the N terminal of human MAFK. Synthetic peptide located within the following region: KEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGY