Rabbit Polyclonal Anti-OCT2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OCT2 Antibody: A synthesized peptide derived from human 41184 |
Rabbit Polyclonal Anti-OCT2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OCT2 Antibody: A synthesized peptide derived from human 41184 |
Anti-POU2F2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 200 amino acids of human POU class 2 homeobox 2 |
Rabbit polyclonal anti-OCT2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human OCT2 antibody. |
Rabbit Polyclonal Anti-POU2F2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-POU2F2 Antibody: synthetic peptide directed towards the N terminal of human POU2F2. Synthetic peptide located within the following region: SPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPSTKIKAEDPSGDSAPA |
Rabbit anti OCT-2 Polyclonal Antibody
Applications | Dot |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to C-terminus of OCT-2 protein from human, mouse and rat origins. |
Anti-POU2F2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 200 amino acids of human POU class 2 homeobox 2 |
Mouse Monoclonal OCT-2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |