Rabbit Polyclonal POU3F2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal POU3F2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human POU3F2. |
Rabbit Polyclonal POU3F2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal POU3F2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human POU3F2. |
Rabbit Polyclonal anti-POU3F2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POU3F2 antibody: synthetic peptide directed towards the middle region of human POU3F2. Synthetic peptide located within the following region: LGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPG |
POU3F2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 198-226 amino acids from the central region of human POU3F2 |
Goat Anti-POU3F2 / BRN2 / OCT7 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-AQSLVQGDYGALQSN, from the internal region (near N Terminus) of the protein sequence according to NP_005595.2. |
Rabbit Polyclonal Anti-POU3F2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POU3F2 antibody: synthetic peptide directed towards the C terminal of human POU3F2. Synthetic peptide located within the following region: QLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTP |