Primary Antibodies

View as table Download

Rabbit Polyclonal VENTX Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VENTX antibody was raised against a 16 amino acid synthetic peptide near the center of human VENTX.

Rabbit polyclonal anti-VENTX antibody

Applications WB
Reactivities Human, Mouse, Rat, Xenopus
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 76 of human VENTX

Rabbit Polyclonal Anti-VENTX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VENTX antibody: synthetic peptide directed towards the middle region of human VENTX. Synthetic peptide located within the following region: VAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDA

Rabbit Polyclonal Anti-VENTX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VENTX antibody: synthetic peptide directed towards the middle region of human VENTX. Synthetic peptide located within the following region: NLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLE