Primary Antibodies

View as table Download

ZNF217 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 91-120 amino acids from the N-terminal region of Human ZNF217.

Rabbit Polyclonal Anti-ZNF217 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF217 Antibody: synthetic peptide directed towards the N terminal of human ZNF217. Synthetic peptide located within the following region: SQTFTHSEDLNKHVLMQHRPTLCEPAVLRVEAEYLSPLDKSQVRTEPPKE

Rabbit Polyclonal Anti-ZNF217 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF217 Antibody: synthetic peptide directed towards the middle region of human ZNF217. Synthetic peptide located within the following region: QDTEDALLTADSAQTKNLKRFFDGAKDVTGSPPAKQLKEMPSVFQNVLGS

Carrier-free (BSA/glycerol-free) ZNF217 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF217 mouse monoclonal antibody,clone OTI1B10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF217 mouse monoclonal antibody,clone OTI3G5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF217 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF217 mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF217 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications WB
Reactivities Human
Conjugation Unconjugated

ZNF217 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)

Applications WB
Reactivities Human
Conjugation Unconjugated

ZNF217 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

ZNF217 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

ZNF217 mouse monoclonal antibody,clone OTI1B10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ZNF217 mouse monoclonal antibody,clone OTI3G5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ZNF217 mouse monoclonal antibody,clone OTI3G5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ZNF217 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ZNF217 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ZNF217 mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ZNF217 mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ZNF217 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications WB
Reactivities Human
Conjugation Unconjugated

ZNF217 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

ZNF217 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP