ZNF217 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 91-120 amino acids from the N-terminal region of Human ZNF217. |
ZNF217 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 91-120 amino acids from the N-terminal region of Human ZNF217. |
Rabbit Polyclonal Anti-ZNF217 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ZNF217 Antibody: synthetic peptide directed towards the N terminal of human ZNF217. Synthetic peptide located within the following region: SQTFTHSEDLNKHVLMQHRPTLCEPAVLRVEAEYLSPLDKSQVRTEPPKE |
Rabbit Polyclonal Anti-ZNF217 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ZNF217 Antibody: synthetic peptide directed towards the middle region of human ZNF217. Synthetic peptide located within the following region: QDTEDALLTADSAQTKNLKRFFDGAKDVTGSPPAKQLKEMPSVFQNVLGS |
Carrier-free (BSA/glycerol-free) ZNF217 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF217 mouse monoclonal antibody,clone OTI1B10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF217 mouse monoclonal antibody,clone OTI3G5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF217 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF217 mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF217 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ZNF217 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF217 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
ZNF217 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
ZNF217 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ZNF217 mouse monoclonal antibody,clone OTI1B10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF217 mouse monoclonal antibody,clone OTI1B10, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
ZNF217 mouse monoclonal antibody,clone OTI1B10, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ZNF217 mouse monoclonal antibody,clone OTI1B10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ZNF217 mouse monoclonal antibody,clone OTI3G5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF217 mouse monoclonal antibody,clone OTI3G5, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
ZNF217 mouse monoclonal antibody,clone OTI3G5, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ZNF217 mouse monoclonal antibody,clone OTI3G5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ZNF217 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF217 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
ZNF217 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ZNF217 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ZNF217 mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF217 mouse monoclonal antibody, clone OTI2B1 (formerly 2B1), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
ZNF217 mouse monoclonal antibody, clone OTI2B1 (formerly 2B1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ZNF217 mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ZNF217 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF217 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
ZNF217 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
ZNF217 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".