Rabbit Polyclonal Anti-TIM3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TIM3 antibody was raised against a peptide corresponding to 16 amino acids near the amino terminus of human TIM3. The immunogen is located within amino acids 60 - 110 of TIM3. |
Goat Polyclonal Antibody against TIM3 / HAVCR2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KWYSHSKEKIQN, from the internal region of the protein sequence according to NP_116171.3. |
Rabbit polyclonal anti-Tim-3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid residue 285 of human Tim-3 |
Rabbit Polyclonal Anti-HAVCR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAVCR2 antibody: synthetic peptide directed towards the N terminal of human HAVCR2. Synthetic peptide located within the following region: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP |
Germany
Japan
United Kingdom
China
