Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-P2RX7 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen P2RX7 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human P2RX7.

Goat Anti-P2RX7 / P2X7 receptor Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence YETNKVTRIQSMNY-C, from the N-Terminus of the protein sequence according to NP_002553.2.

Rabbit Polyclonal Anti-PDIA1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PDIA1 antibody was raised against a 17 amino acid peptide near the center of human PDIA1.

P2X7 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human, Monkey, Gibbon
Immunogen P2RX7 / P2X7 antibody was raised against synthetic 16 amino acid peptide from internal region of human P2RX7 / P2X7. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Marmoset, Pig (88%); Mouse, Horse (81%).

Rabbit Polyclonal Anti-P2RX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RX7 antibody: synthetic peptide directed towards the middle region of human P2RX7. Synthetic peptide located within the following region: LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRKEFPKSEGQYSGFKSP

Rabbit Polyclonal Anti-P2RX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RX7 antibody: synthetic peptide directed towards the middle region of human P2RX7. Synthetic peptide located within the following region: VKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP