Rabbit Polyclonal Anti-Rubicon Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rubicon antibody was raised against a 16 amino acid peptide near the amino terminus of human Rubicon. |
Rabbit Polyclonal Anti-Rubicon Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rubicon antibody was raised against a 16 amino acid peptide near the amino terminus of human Rubicon. |
Rabbit Polyclonal Anti-ERp72 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ERp72 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human ERp72. |
Rabbit Polyclonal Anti-PDIA4 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDIA4 antibody: synthetic peptide directed towards the N terminal of human PDIA4. Synthetic peptide located within the following region: ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL |
Rabbit Polyclonal Anti-PDIA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDIA4 antibody: synthetic peptide directed towards the middle region of human PDIA4. Synthetic peptide located within the following region: TAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYA |