Rabbit monoclonal anti-RMD3 antibody for SISCAPA, clone OTIR1A2
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-RMD3 antibody for SISCAPA, clone OTIR1A2
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-FAM82A2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FAM82A2 |
Rabbit Polyclonal Anti-FAM82C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FAM82C antibody: synthetic peptide directed towards the middle region of human FAM82C. Synthetic peptide located within the following region: LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA |
Rabbit Polyclonal Anti-RMDN3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RMDN3 |