FAM82A2 (RMDN3) Rabbit Polyclonal Antibody

CAT#: TA342359

Rabbit Polyclonal Anti-FAM82C Antibody

Product Images

WB Suggested Anti-FAM82C Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAM82C antibody: synthetic peptide directed towards the middle region of human FAM82C. Synthetic peptide located within the following region: LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: regulator of microtubule dynamics 3
• Database Link:
  NP_060615
  Entrez Gene 55177 Human
  UniProt ID Q96TC7
• Background: FAM82C may participate in differentiation and apoptosis of keratinocytes. Overexpression of FAM82C protein induces apoptosis.
• Synonyms: FAM82A2; FAM82C; ptpip51; RMD-3; RMD3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane