Primary Antibodies

Jump to Filters
View as table Download
SLC22A2 Rabbit Polyclonal Antibody
TA334041

USD 310.00

5 Days

Rabbit Polyclonal Anti-SLC22A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC22A2 Antibody: synthetic peptide directed towards the N terminal of human SLC22A2. Synthetic peptide located within the following region: MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHR
SLC22A2 Rabbit Polyclonal Antibody
TA351470

USD 345.00

In Stock

Rabbit Polyclonal Anti-SLC22A2 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC22A2