SLC22A2 Rabbit Polyclonal Antibody

CAT#: TA334041

Rabbit Polyclonal Anti-SLC22A2 Antibody

Product Images

WB Suggested Anti-SLC22A2 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC22A2 Antibody: synthetic peptide directed towards the N terminal of human SLC22A2. Synthetic peptide located within the following region: MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: solute carrier family 22 member 2
• Database Link:
  NP_003049
  Entrez Gene 6582 Human
  UniProt ID O15244
• Background: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A2 is one of the three similar cation transporters. SLC22A2 contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption. Two transcript variants encoding different isoforms have been found for this gene.
• Synonyms: OCT2
• Note: Immunogen sequence homology: Human: 100%; Mouse: 92%; Rat: 85%; Dog: 83%; Pig: 83%; Horse: 83%; Bovine: 83%; Rabbit: 83%; Guinea pig: 83%

Reference Data

• Protein Families: Transmembrane