Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HSD3B1 Antibody
Applications | WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSD3B1 antibody: synthetic peptide directed towards the N terminal of human HSD3B1. Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ |
Rabbit polyclonal CD38 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | PGES / PTGES antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Rabbit, Pig (100%); Hamster, Bovine (94%); Dog, Horse, Turkey, Chicken (88%); Pike (81%). |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
Conjugation | Unconjugated |
Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
Anti-COMT Goat Polyclonal Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | COMT antibody was raised against synthetic peptide GDTKEQRILNHVLQC from the N-terminus of human COMT (NP_000745.1; NP_001128633.1; NP_001128634.1; NP_009294.1). Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Marmoset, Panda, Dog (93%); Hamster, Bat, Horse (86%). |
Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697) |
Rabbit Polyclonal antibody to NAT2 (N-acetyltransferase 2 (arylamine N-acetyltransferase))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 198 of NAT2 (Uniprot ID#P11245) |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Chicken, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | PGES / PTGES antibody was raised against synthetic 14 amino acid peptide from near N-terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Rat, Bovine, Dog, Elephant, Panda, Rabbit, Horse, Pig, Opossum, Turkey, Chicken, Platypus, Pufferfish, Zebrafish, Stickleback (100%); Mouse, Xenopus, Pike (93%). |
Rabbit Polyclonal Anti-HSD3B2 Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSD3B2 antibody: synthetic peptide directed towards the N terminal of human HSD3B2. Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN |
CD203c Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Dog, Human, Monkey, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset, Dog (100%); Bovine, Horse, Pig (95%); Panda, Bat (84%). |
CD203c Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Monkey, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Monkey (100%); Gibbon (95%); Rat, Rabbit, Pig (80%). |
CD203c Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Human |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Orangutan, Marmoset (95%); Horse, Rabbit (84%). |
Rabbit Polyclonal Anti-GCNT3 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GCNT3 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human GCNT3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (93%); Marmoset (80%). |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CYP2A6 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | HRP |
USD 159.00
2 Days
ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), Biotinylated
Applications | WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), HRP conjugated
Applications | WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | HRP |
USD 159.00
2 Days
ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | HRP |
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
CYP2A6 (Cytochrome P450 2A6) mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
CYP2A6 mouse monoclonal antibody,clone 1D2, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
CYP2A6 mouse monoclonal antibody,clone 1D2, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | HRP |
USD 159.00
In Stock
CYP2A6 (Cytochrome P450 2A6) mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |