Primary Antibodies

View as table Download

Rabbit anti-CHRNA1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CHRNA1

Rabbit Polyclonal Anti-CHRNA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the C terminal of human CHRNA1. Synthetic peptide located within the following region: STHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISG

Rabbit Polyclonal Anti-CHRNA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the N terminal of human CHRNA1. Synthetic peptide located within the following region: TRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNV

Rabbit Polyclonal Anti-CHRNA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the N terminal of human CHRNA1. Synthetic peptide located within the following region: AGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVD

Rabbit Polyclonal Anti-CHRNA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHRNA1