Primary Antibodies

View as table Download

Rabbit polyclonal anti-A4GNT antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human A4GNT.

Goat Anti-A4GNT / alpha4GNT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PRTYRDLIKGPEGS, from the C Terminus of the protein sequence according to NP_057245.1.

Rabbit Polyclonal Anti-A4GNT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-A4GNT antibody: synthetic peptide directed towards the N terminal of human A4GNT. Synthetic peptide located within the following region: LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERME

Rabbit Polyclonal Anti-A4GNT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-A4GNT antibody: synthetic peptide directed towards the C terminal of human A4GNT. Synthetic peptide located within the following region: NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV

Carrier-free (BSA/glycerol-free) A4GNT mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) A4GNT mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) A4GNT mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) A4GNT mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) A4GNT mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Anti-A4GNT Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 28-340 amino acids of human alpha-1,4-N-acetylglucosaminyltransferase

Anti-A4GNT Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 28-340 amino acids of human alpha-1,4-N-acetylglucosaminyltransferase

A4GNT mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

A4GNT mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

A4GNT mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

A4GNT mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

A4GNT mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

A4GNT mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

A4GNT mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)

Applications WB
Reactivities Human
Conjugation Unconjugated

A4GNT mouse monoclonal antibody,clone 2C1, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

A4GNT mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)

Applications WB
Reactivities Human
Conjugation Unconjugated

A4GNT mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications WB
Reactivities Human
Conjugation Unconjugated

A4GNT mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications WB
Reactivities Human
Conjugation Unconjugated