A4GNT Rabbit Polyclonal Antibody

CAT#: TA342000

Rabbit Polyclonal Anti-A4GNT Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "A4GNT"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-A4GNT antibody: synthetic peptide directed towards the N terminal of human A4GNT. Synthetic peptide located within the following region: LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERME
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name alpha-1,4-N-acetylglucosaminyltransferase
Background This gene encodes a protein fromThe glycosyltransferase 32 family.The enzyme catalyzesThe transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-->4Galbeta-->R and is largely associated withThe Golgi apparatus membrane. [provided by RefSeq, Jul 2008]
Synonyms alpha4GnT
Note Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 83%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.