Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-A4GNT antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human A4GNT. |
Antibodies
View as table Download
Goat Anti-A4GNT / alpha4GNT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PRTYRDLIKGPEGS, from the C Terminus of the protein sequence according to NP_057245.1. |
Rabbit Polyclonal Anti-A4GNT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-A4GNT antibody: synthetic peptide directed towards the N terminal of human A4GNT. Synthetic peptide located within the following region: LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERME |
Rabbit Polyclonal Anti-A4GNT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-A4GNT antibody: synthetic peptide directed towards the C terminal of human A4GNT. Synthetic peptide located within the following region: NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV |
Carrier-free (BSA/glycerol-free) A4GNT mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) A4GNT mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-A4GNT Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 28-340 amino acids of human alpha-1,4-N-acetylglucosaminyltransferase |
A4GNT Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-340 of human A4GNT (NP_057245.1). |
| Modifications | Unmodified |
A4GNT mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
A4GNT mouse monoclonal antibody,clone 2C1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
A4GNT mouse monoclonal antibody,clone 2C1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
A4GNT mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
A4GNT mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
A4GNT mouse monoclonal antibody,clone 1B10, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
A4GNT mouse monoclonal antibody,clone 1B10, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
A4GNT mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- A4GNT