Primary Antibodies

View as table Download

Rabbit polyclonal antibody to PTGES2 (prostaglandin E synthase 2)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 106 and 343 of PTGES2 (Uniprot ID#Q9H7Z7)

Rabbit Polyclonal Anti-PTGES2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGES2 antibody is: synthetic peptide directed towards the N-terminal region of Human PTGES2. Synthetic peptide located within the following region: KEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVHLISPN

Rabbit Polyclonal Anti-PTGES2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGES2 antibody is: synthetic peptide directed towards the middle region of Human PTGES2. Synthetic peptide located within the following region: VAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKDRPFMG

Anti-PTGES2 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 90-377 amino acids of human prostaglandin E synthase 2

Anti-PTGES2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 90-377 amino acids of human prostaglandin E synthase 2