PTGES2 Rabbit Polyclonal Antibody

CAT#: TA337709

Rabbit Polyclonal Anti-PTGES2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PTGES2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PTGES2 antibody is: synthetic peptide directed towards the middle region of Human PTGES2. Synthetic peptide located within the following region: VAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKDRPFMG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 21 kDa
Gene Name prostaglandin E synthase 2
Background The protein encoded by this gene is a membrane-associated prostaglandin E synthase, which catalyzes the conversion of prostaglandin H2 to prostaglandin E2. This protein also has been shown to activate the transcription regulated by a gamma-interferon-activated transcription element (GATE). Multiple transcript variants have been found for this gene.
Synonyms C9orf15; GBF-1; GBF1; mPGES-2; PGES2
Note Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Guinea pig: 86%; Rat: 79%; Horse: 79%; Mouse: 79%
Reference Data
Protein Pathways Arachidonic acid metabolism, Metabolic pathways

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.